PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp6g08360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family ARF
Protein Properties Length: 475aa    MW: 54214.9 Da    PI: 7.6243
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp6g08360genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B335.22.3e-11116178158
                EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTE CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgr 58 
                f kvl+ sd++++g l++pkk+a+e+     ++ ++ +++++ +d++g +W++k+i+r+k g+
  Tp6g08360 116 FNKVLSASDMSRHGGLSIPKKHASEClpqldMSHPTPTQEIVAKDLHGYEWRFKHIFRGKNGE 178
                89****************************955566677*****************9776654 PP

2Auxin_resp86.84.2e-29211290183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 aa+a++tk++F v+Y+Pr+  s+F+v+++ + +a+++k+ +G++f m fe +d+s++r+sGt++g++d  ++ W+nS+WrsL+
   Tp6g08360 211 AANAINTKCMFIVFYKPRS--SQFIVSCDTFINAVNNKFNIGSKFTMWFEDNDFSKIRYSGTIIGIQD-FSIYWKNSEWRSLE 290
                 799***************6..9**********************************************.567*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.62E-20108175IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.6E-19110177IPR015300DNA-binding pseudobarrel domain
CDDcd100177.33E-11114177No hitNo description
PfamPF023622.4E-9116178IPR003340B3 DNA binding domain
PfamPF065072.4E-26211289IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MSNNEASDET KSYLYDELWK LCAGPLFVLP RFGEQIYYFP QGHMEQVDTS TNEDLAEVKP  60
IFDLPSKIRC TVIGIQLKVE NDTDQIYAQI TLLPDTTEVR IPILNDDLES PKIHFFNKVL  120
SASDMSRHGG LSIPKKHASE CLPQLDMSHP TPTQEIVAKD LHGYEWRFKH IFRGKNGESR  180
VGIRRAAHER GNVSSSVISK QSMYHGLIAD AANAINTKCM FIVFYKPRSS QFIVSCDTFI  240
NAVNNKFNIG SKFTMWFEDN DFSKIRYSGT IIGIQDFSIY WKNSEWRSLE VQWDEAASIP  300
RPTKVSPWEI QHLPPSLNVP NTSFLNNKRL RHVDENGANW WIPKLNQCQE IGESSKNASM  360
SVPQLSYHHA TNDLKIPYDL LMSNSVPAIS KLSYNDQMVL STKEKITTNA TTSCRIFGVD  420
MMIPNVRPIN VYPKSEIFKI SKEKGFHQTQ TSISPKEDKK QLIIPIINLT YLIVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-10123133355Auxin response factor 1
4ldw_A1e-10123133355Auxin response factor 1
4ldw_B1e-10123133355Auxin response factor 1
4ldx_A1e-10123133355Auxin response factor 1
4ldx_B1e-10123133355Auxin response factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006396992.10.0hypothetical protein EUTSA_v10029379mg
SwissprotQ9LQE81e-175ARFN_ARATH; Putative auxin response factor 14
TrEMBLV4KKN90.0V4KKN9_EUTSA; Auxin response factor
STRINGAT1G35540.11e-172(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35540.11e-176auxin response factor 14